Lineage for d7jsxm2 (7jsx M:150-461)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2447081Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2447082Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2447083Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2447107Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69403] (6 PDB entries)
  8. 2447134Domain d7jsxm2: 7jsx M:150-461 [394620]
    Other proteins in same PDB: d7jsxa1, d7jsxb_, d7jsxc1, d7jsxd_, d7jsxe1, d7jsxf_, d7jsxg1, d7jsxh_, d7jsxi1, d7jsxj_, d7jsxk1, d7jsxl_, d7jsxm1, d7jsxn_, d7jsxo1, d7jsxp_
    automated match to d1gk8a1

Details for d7jsxm2

PDB Entry: 7jsx (more details), 2.06 Å

PDB Description: epyc1(106-135) peptide-bound rubisco
PDB Compounds: (M:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d7jsxm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jsxm2 c.1.14.1 (M:150-461) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacev

SCOPe Domain Coordinates for d7jsxm2:

Click to download the PDB-style file with coordinates for d7jsxm2.
(The format of our PDB-style files is described here.)

Timeline for d7jsxm2: