Lineage for d7jsxh_ (7jsx H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564397Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2564398Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2564399Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2564562Protein automated matches [190066] (7 species)
    not a true protein
  7. 2564563Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries)
  8. 2564607Domain d7jsxh_: 7jsx H: [394618]
    Other proteins in same PDB: d7jsxa1, d7jsxa2, d7jsxc1, d7jsxc2, d7jsxe1, d7jsxe2, d7jsxg1, d7jsxg2, d7jsxi1, d7jsxi2, d7jsxk1, d7jsxk2, d7jsxm1, d7jsxm2, d7jsxo1, d7jsxo2
    automated match to d1ir21_

Details for d7jsxh_

PDB Entry: 7jsx (more details), 2.06 Å

PDB Description: epyc1(106-135) peptide-bound rubisco
PDB Compounds: (H:) Ribulose bisphosphate carboxylase small chain 2, chloroplastic

SCOPe Domain Sequences for d7jsxh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jsxh_ d.73.1.1 (H:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpksardwqpankr

SCOPe Domain Coordinates for d7jsxh_:

Click to download the PDB-style file with coordinates for d7jsxh_.
(The format of our PDB-style files is described here.)

Timeline for d7jsxh_: