| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
| Protein automated matches [190066] (7 species) not a true protein |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries) |
| Domain d7jn4j_: 7jn4 J: [394610] Other proteins in same PDB: d7jn4a1, d7jn4a2, d7jn4c1, d7jn4c2, d7jn4e1, d7jn4e2, d7jn4g1, d7jn4g2, d7jn4i1, d7jn4i2, d7jn4k1, d7jn4k2, d7jn4m1, d7jn4m2, d7jn4o1, d7jn4o2 automated match to d1ir21_ |
PDB Entry: 7jn4 (more details), 2.68 Å
SCOPe Domain Sequences for d7jn4j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jn4j_ d.73.1.1 (J:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpksardwqpankr
Timeline for d7jn4j_: