Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (6 PDB entries) |
Domain d7jsxi1: 7jsx I:18-149 [394602] Other proteins in same PDB: d7jsxa2, d7jsxb_, d7jsxc2, d7jsxd_, d7jsxe2, d7jsxf_, d7jsxg2, d7jsxh_, d7jsxi2, d7jsxj_, d7jsxk2, d7jsxl_, d7jsxm2, d7jsxn_, d7jsxo2, d7jsxp_ automated match to d1gk8a2 |
PDB Entry: 7jsx (more details), 2.06 Å
SCOPe Domain Sequences for d7jsxi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jsxi1 d.58.9.1 (I:18-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} kdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvwtdgltsl drykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkalralrled lrippayvktfv
Timeline for d7jsxi1: