Lineage for d1qltb1 (1qlt B:274-560)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80860Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (3 families) (S)
  5. 80861Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins)
  6. 80868Protein Vanillyl-alcohol oxidase [55105] (1 species)
  7. 80869Species Fungus (Penicillium simplicissimum) [TaxId:69488] [55106] (12 PDB entries)
  8. 80873Domain d1qltb1: 1qlt B:274-560 [39458]
    Other proteins in same PDB: d1qlta2, d1qltb2

Details for d1qltb1

PDB Entry: 1qlt (more details), 2.2 Å

PDB Description: structure of the h422a mutant of the flavoenzyme vanillyl-alcohol oxidase

SCOP Domain Sequences for d1qltb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qltb1 d.58.32.1 (B:274-560) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
ggyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep
lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens
vlrvrdktmqgiptydelkwidwlpngaalffspiakvsgedammqyavtkkrcqeagld
figtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgeyrthlafmdqi
metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl

SCOP Domain Coordinates for d1qltb1:

Click to download the PDB-style file with coordinates for d1qltb1.
(The format of our PDB-style files is described here.)

Timeline for d1qltb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qltb2