SCOPe 2.08: Domain d7jo3a1: 7jo3 A:4-258

Lineage for d7jo3a1 (7jo3 A:4-258)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (974 PDB entries)
   Uniprot P00918

8. Domain d7jo3a1: 7jo3 A:4-258 [394569]
   Other proteins in same PDB: d7jo3a2
   automated match to d4r5aa_
   complexed with dms, vgs, zn

Details for d7jo3a1

PDB Entry: 7jo3, 1.45 Å

PDB Description: carbonic anhydrase ix mimic complexed with n-(5-sulfamoyl-1,3,4- thiadiazol-2-yl)pivalamide

PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d7jo3a1:

Sequence; same for both SEQRES and ATOM records:

>d7jo3a1 b.74.1.1 (A:4-258) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqika

Timeline for d7jo3a1:

• d7jo3a1 first appeared in SCOPe 2.07