Lineage for d7jn4d_ (7jn4 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564397Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2564398Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2564399Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2564562Protein automated matches [190066] (7 species)
    not a true protein
  7. 2564563Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries)
  8. 2564613Domain d7jn4d_: 7jn4 D: [394540]
    Other proteins in same PDB: d7jn4a1, d7jn4a2, d7jn4c1, d7jn4c2, d7jn4e1, d7jn4e2, d7jn4g1, d7jn4g2, d7jn4i1, d7jn4i2, d7jn4k1, d7jn4k2, d7jn4m1, d7jn4m2, d7jn4o1, d7jn4o2
    automated match to d1ir21_

Details for d7jn4d_

PDB Entry: 7jn4 (more details), 2.68 Å

PDB Description: rubisco in the apo state
PDB Compounds: (D:) Ribulose bisphosphate carboxylase small chain 2, chloroplastic

SCOPe Domain Sequences for d7jn4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jn4d_ d.73.1.1 (D:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpksardwqpankr

SCOPe Domain Coordinates for d7jn4d_:

Click to download the PDB-style file with coordinates for d7jn4d_.
(The format of our PDB-style files is described here.)

Timeline for d7jn4d_: