Class b: All beta proteins [48724] (178 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (4 families) also contains 8-bladed propellers |
Family b.69.4.0: automated matches [191412] (1 protein) not a true family |
Protein automated matches [190568] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187559] (91 PDB entries) |
Domain d7dh6c_: 7dh6 C: [394537] automated match to d4yvda_ complexed with ca, ni, so4 |
PDB Entry: 7dh6 (more details), 2.58 Å
SCOPe Domain Sequences for d7dh6c_:
Sequence, based on SEQRES records: (download)
>d7dh6c_ b.69.4.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qwhppwklyrvisghlgwvrciavepgnqwfvtgsadrtikiwdlasgklklsltghist vrgvivstrspylfscgedkqvkcwdleynkvirhyhghlsavygldlhptidvlvtcsr dstariwdvrtkasvhtlsghtnavatvrcqaaepqiitgshdttirlwdlvagktrvtl tnhkksvravvlhprhytfasgspdnikqwkfpdgsfiqnlsghnaiintltvnsdgvlv sgadngtmhlwdwrtgynfqrvhaavqpgsldsesgifacafdqsesrlltaeadktikv yred
>d7dh6c_ b.69.4.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qwhppwklyrvisghlgwvrciavepgnqwfvtgsadrtikiwdlasgklklsltghist vrgvivstrspylfscgedkqvkcwdleynkvirhyhghlsavygldlhptidvlvtcsr dstariwdvsvhtlsghtnavatvrcqaaepqiitgshdttirlwdlvagktrvtltnhk ksvravvlhprhytfasgspdnikqwkfpdgsfiqnlsghnaiintltvnsdgvlvsgad ngtmhlwdwrtgynfqrvhasesgifacafdqsesrlltaeadktikvyred
Timeline for d7dh6c_: