Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Alkaliphilus oremlandii [TaxId:350688] [260042] (5 PDB entries) |
Domain d7c10d_: 7c10 D: [394533] automated match to d3zija_ |
PDB Entry: 7c10 (more details), 2.81 Å
SCOPe Domain Sequences for d7c10d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c10d_ c.47.1.0 (D:) automated matches {Alkaliphilus oremlandii [TaxId: 350688]} evivytsntcphcftvkeflsennveftekniqtdaaarkelmkkgimavpviqideevv vgfdrdkieellg
Timeline for d7c10d_:
View in 3D Domains from other chains: (mouse over for more information) d7c10a_, d7c10b_, d7c10c_, d7c10e_ |