Lineage for d7c10d_ (7c10 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2486921Species Alkaliphilus oremlandii [TaxId:350688] [260042] (5 PDB entries)
  8. 2486929Domain d7c10d_: 7c10 D: [394533]
    automated match to d3zija_

Details for d7c10d_

PDB Entry: 7c10 (more details), 2.81 Å

PDB Description: dithiol cgrx1
PDB Compounds: (D:) glutaredoxin

SCOPe Domain Sequences for d7c10d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7c10d_ c.47.1.0 (D:) automated matches {Alkaliphilus oremlandii [TaxId: 350688]}
evivytsntcphcftvkeflsennveftekniqtdaaarkelmkkgimavpviqideevv
vgfdrdkieellg

SCOPe Domain Coordinates for d7c10d_:

Click to download the PDB-style file with coordinates for d7c10d_.
(The format of our PDB-style files is described here.)

Timeline for d7c10d_: