SCOPe 2.05: Domain d1e6yb2: 1e6y B:2002-2185

Lineage for d1e6yb2 (1e6y B:2002-2185)

Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)

each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
C-terminal domain is all-alpha
Protein Beta chain [55099] (3 species)
Species Methanosarcina barkeri [TaxId:2208] [55102] (1 PDB entry)
Domain d1e6yb2: 1e6y B:2002-2185 [39453]
Other proteins in same PDB: d1e6ya1, d1e6ya2, d1e6yb1, d1e6yc_, d1e6yd1, d1e6yd2, d1e6ye1, d1e6yf_
complexed with com, f43, gol, tp7

Details for d1e6yb2

PDB Entry: 1e6y (more details), 1.6 Å

PDB Description: methyl-coenzyme m reductase from methanosarcina barkeri

PDB Compounds: (B:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1e6yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6yb2 d.58.31.2 (B:2002-2185) Beta chain {Methanosarcina barkeri [TaxId: 2208]}
sdtvdiyddrgkllesnvdimslaptrnaaiqsiimdtkrsvavnlagiqgalasgkmgg
kgrqilgrglnydivgnadaiaenvkklvqvdegddtnvikvkggkslliqspksriiag
adfmsattvgaaavtqtimdmfgtdpydapivksavwgsypqtmdlmggqvqgilsipqn
negl

SCOPe Domain Coordinates for d1e6yb2:

Click to download the PDB-style file with coordinates for d1e6yb2.
(The format of our PDB-style files is described here.)

Timeline for d1e6yb2: