Lineage for d1e6yb2 (1e6y B:2002-2185)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80803Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
  5. 80823Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
  6. 80842Protein Beta chain [55099] (3 species)
  7. 80857Species Archaeon Methanosarcina barkeri [TaxId:2208] [55102] (1 PDB entry)
  8. 80858Domain d1e6yb2: 1e6y B:2002-2185 [39453]
    Other proteins in same PDB: d1e6ya1, d1e6ya2, d1e6yb1, d1e6yc_, d1e6yd1, d1e6yd2, d1e6ye1, d1e6yf_

Details for d1e6yb2

PDB Entry: 1e6y (more details), 1.6 Å

PDB Description: methyl-coenzyme m reductase from methanosarcina barkeri

SCOP Domain Sequences for d1e6yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6yb2 d.58.31.2 (B:2002-2185) Beta chain {Archaeon Methanosarcina barkeri}
sdtvdiyddrgkllesnvdimslaptrnaaiqsiimdtkrsvavnlagiqgalasgkmgg
kgrqilgrglnydivgnadaiaenvkklvqvdegddtnvikvkggkslliqspksriiag
adfmsattvgaaavtqtimdmfgtdpydapivksavwgsypqtmdlmggqvqgilsipqn
negl

SCOP Domain Coordinates for d1e6yb2:

Click to download the PDB-style file with coordinates for d1e6yb2.
(The format of our PDB-style files is described here.)

Timeline for d1e6yb2: