SCOPe 2.07: Domain d7d7ta2: 7d7t A:63-316

Lineage for d7d7ta2 (7d7t A:63-316)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein automated matches [310868] (6 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [385225] (32 PDB entries)

8. Domain d7d7ta2: 7d7t A:63-316 [394501]
   Other proteins in same PDB: d7d7ta1, d7d7tb1
   automated match to d4m0wa2
   complexed with gyx, zn; mutant

Details for d7d7ta2

PDB Entry: 7d7t, 3.15 Å

PDB Description: crystal structure of the sars-cov-2 papain-like protease (plpro) c112s mutant bound to compound s43

PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d7d7ta2:

Sequence; same for both SEQRES and ATOM records:

>d7d7ta2 d.3.1.23 (A:63-316) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
dtlrveafeyyhttdpsflgrymsalnhtkkwkypqvngltsikwadnnsylatalltlq
qielkfnppalqdayyrarageaanfcalilaycnktvgelgdvretmsylfqhanldsc
krvlnvvcktcgqqqttlkgveavmymgtlsyeqfkkgvqipctcgkqatkylvqqespf
vmmsappaqyelkhgtftcaseytgnyqcghykhitsketlycidgalltksseykgpit
dvfykensytttik

Timeline for d7d7ta2:

• d7d7ta2 is new in SCOPe 2.07-stable
  
• d7d7ta2 does not appear in SCOPe 2.08