Lineage for d1mroe2 (1mro E:2-188)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1911012Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1911046Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 1911077Protein Beta chain [55099] (3 species)
  7. 1911078Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries)
  8. 1911082Domain d1mroe2: 1mro E:2-188 [39450]
    Other proteins in same PDB: d1mroa1, d1mroa2, d1mrob1, d1mroc_, d1mrod1, d1mrod2, d1mroe1, d1mrof_
    complexed with com, f43, gol, na, tp7, zn

Details for d1mroe2

PDB Entry: 1mro (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase
PDB Compounds: (E:) methyl-coenzyme m reductase

SCOPe Domain Sequences for d1mroe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mroe2 d.58.31.2 (E:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

SCOPe Domain Coordinates for d1mroe2:

Click to download the PDB-style file with coordinates for d1mroe2.
(The format of our PDB-style files is described here.)

Timeline for d1mroe2: