Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (87 species) not a true protein |
Species Niastella koreensis [TaxId:700598] [394489] (4 PDB entries) |
Domain d7cvxa_: 7cvx A: [394490] Other proteins in same PDB: d7cvxb2 automated match to d4oa5a_ complexed with dhb, gol, mg, sah |
PDB Entry: 7cvx (more details), 1.7 Å
SCOPe Domain Sequences for d7cvxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cvxa_ c.66.1.0 (A:) automated matches {Niastella koreensis [TaxId: 700598]} nqifesvdhyisdllgyeddallaatnslaeagmpaisvspnqgkflqllaqlcqaknil elgtlagystiwmaralpkngrlitleydpkhaavaqknidragltsqvqirtgkaidil pqlveegagpfdmifidadkppyteyfqwalrlsrpgtlivadnvirdgkvldenstepa vqgarrfnamlgantavdatilqmvgvkeydgmalaivk
Timeline for d7cvxa_: