![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.330: ERH-like [143874] (1 superfamily) beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10 |
![]() | Superfamily d.330.1: ERH-like [143875] (1 family) ![]() automatically mapped to Pfam PF01133 |
![]() | Family d.330.1.1: ERH-like [143876] (2 proteins) Pfam PF01133 |
![]() | Protein Enhancer of rudimentary homolog, ERH [143877] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [143878] (5 PDB entries) Uniprot P84089 1-104! Uniprot P84090 2-101 also includes 100% identical human protein P84090 (1W9G) |
![]() | Domain d7cnca_: 7cnc A: [394471] automated match to d1w9ga_ |
PDB Entry: 7cnc (more details), 1.6 Å
SCOPe Domain Sequences for d7cnca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cnca_ d.330.1.1 (A:) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]} mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf iddladlsclvyradtqtyqpynkdwikekiyvllrrqaq
Timeline for d7cnca_: