Lineage for d1e6ya2 (1e6y A:1002-1283)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1654623Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1654657Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 1654658Protein Alpha chain [55095] (3 species)
  7. 1654685Species Methanosarcina barkeri [TaxId:2208] [55098] (1 PDB entry)
  8. 1654686Domain d1e6ya2: 1e6y A:1002-1283 [39447]
    Other proteins in same PDB: d1e6ya1, d1e6yb1, d1e6yb2, d1e6yc_, d1e6yd1, d1e6ye1, d1e6ye2, d1e6yf_
    complexed with com, f43, gol, tp7

Details for d1e6ya2

PDB Entry: 1e6y (more details), 1.6 Å

PDB Description: methyl-coenzyme m reductase from methanosarcina barkeri
PDB Compounds: (A:) methyl-coenzyme m reductase subunit alpha

SCOPe Domain Sequences for d1e6ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ya2 d.58.31.2 (A:1002-1283) Alpha chain {Methanosarcina barkeri [TaxId: 2208]}
aadifskfkkdmevkfaqefgsnkqtggditdktakflrlgpeqdprkvemikagkeiae
krgiafynpmmhsgaplgqraitpytisgtdivcepddlhyvnnaamqqmwddirrtciv
gldmahetlekrlgkevtpetinhylevlnhampgaavvqemmvethpalvddcyvkvft
gddaladeidkqflidinkefseeqaaqikasigktswqaihiptivsrttdgaqtsrwa
amqigmsfisayamcageaavadlsfaakhaalvsmgemlpa

SCOPe Domain Coordinates for d1e6ya2:

Click to download the PDB-style file with coordinates for d1e6ya2.
(The format of our PDB-style files is described here.)

Timeline for d1e6ya2: