Lineage for d1e6vd2 (1e6v D:8-272)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 33089Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
  5. 33101Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
  6. 33102Protein Alpha chain [55095] (3 species)
  7. 33106Species Methanopyrus kandleri [TaxId:2320] [55097] (1 PDB entry)
  8. 33108Domain d1e6vd2: 1e6v D:8-272 [39446]
    Other proteins in same PDB: d1e6va1, d1e6vb1, d1e6vb2, d1e6vc_, d1e6vd1, d1e6ve1, d1e6ve2, d1e6vf_

Details for d1e6vd2

PDB Entry: 1e6v (more details), 2.7 Å

PDB Description: methyl-coenzyme m reductase from methanopyrus kandleri

SCOP Domain Sequences for d1e6vd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6vd2 d.58.31.2 (D:8-272) Alpha chain {Methanopyrus kandleri}
lfmkalkekfeespeekytkfyifggwkqserkkefkewadkiveergvphynpdigvpl
gqrklmsyqvsgtdvfvegddltfvnnaamqqmwddirrtvivgmdtahrvlerrlgkev
tpetineymetlnhalpggavvqehmveihpgltwdcyakiitgdleladeiddkflidi
eklfpeeqaeqlikaignrtyqvcrmptivghvcdgatmyrwaamqiamsficaykiaag
eaavsdfafaskhaevinmgemlpa

SCOP Domain Coordinates for d1e6vd2:

Click to download the PDB-style file with coordinates for d1e6vd2.
(The format of our PDB-style files is described here.)

Timeline for d1e6vd2: