Lineage for d7aoba1 (7aob A:1-143)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848796Species Thermaerobacter marianensis [TaxId:73919] [394276] (1 PDB entry)
  8. 2848797Domain d7aoba1: 7aob A:1-143 [394393]
    Other proteins in same PDB: d7aoba2, d7aobb2, d7aobc2, d7aobd2
    automated match to d3tl2a1
    complexed with 1pe, edo, gol, peg, pge

Details for d7aoba1

PDB Entry: 7aob (more details), 2.12 Å

PDB Description: crystal structure of thermaerobacter marianensis malate dehydrogenase
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d7aoba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7aoba1 c.2.1.0 (A:1-143) automated matches {Thermaerobacter marianensis [TaxId: 73919]}
mkrpkvsivgagntgaalahwlaikqvadivlvdvvegmpqgkaldlmqsapvegfdvvi
tgsndyaatagsdvvvitagaarkpgmsrddlvnintgivreitaqvaryspdaylivlt
npldvmcyvaykvsgfpkhrvmg

SCOPe Domain Coordinates for d7aoba1:

Click to download the PDB-style file with coordinates for d7aoba1.
(The format of our PDB-style files is described here.)

Timeline for d7aoba1: