Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Thermaerobacter marianensis [TaxId:73919] [394276] (1 PDB entry) |
Domain d7aoba1: 7aob A:1-143 [394393] Other proteins in same PDB: d7aoba2, d7aobb2, d7aobc2, d7aobd2 automated match to d3tl2a1 complexed with 1pe, edo, gol, peg, pge |
PDB Entry: 7aob (more details), 2.12 Å
SCOPe Domain Sequences for d7aoba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7aoba1 c.2.1.0 (A:1-143) automated matches {Thermaerobacter marianensis [TaxId: 73919]} mkrpkvsivgagntgaalahwlaikqvadivlvdvvegmpqgkaldlmqsapvegfdvvi tgsndyaatagsdvvvitagaarkpgmsrddlvnintgivreitaqvaryspdaylivlt npldvmcyvaykvsgfpkhrvmg
Timeline for d7aoba1: