Lineage for d1cbka_ (1cbk A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 33079Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) (S)
  5. 33080Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)
  6. 33081Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (2 species)
  7. 33086Species Haemophilus influenzae [TaxId:727] [55087] (1 PDB entry)
  8. 33087Domain d1cbka_: 1cbk A: [39435]

Details for d1cbka_

PDB Entry: 1cbk (more details), 2.02 Å

PDB Description: 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase from haemophilus influenzae

SCOP Domain Sequences for d1cbka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbka_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Haemophilus influenzae}
mitayialgsnlntpveqlhaalkaisqlsnthlvttssfykskplgpqdqpdyvnavak
ietelsplklldelqrieneqgrvrlrrwgertldldillygneiiqnerltiphydmhn
refvivplfeiasdlvlpnsqiitelvkqfadhkmiklnp

SCOP Domain Coordinates for d1cbka_:

Click to download the PDB-style file with coordinates for d1cbka_.
(The format of our PDB-style files is described here.)

Timeline for d1cbka_: