Lineage for d1dy3a_ (1dy3 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 413110Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) (S)
    common fold is elaborated with additional secondary structures
  5. 413111Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)
  6. 413112Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (2 species)
  7. 413113Species Escherichia coli [TaxId:562] [55086] (15 PDB entries)
  8. 413128Domain d1dy3a_: 1dy3 A: [39434]
    complexed with 87y, atp, mg

Details for d1dy3a_

PDB Entry: 1dy3 (more details), 2 Å

PDB Description: ternary complex of 7,8-dihydro-6-hydroxymethylpterinpyrophosphokinase from escherichia coli with atp and a substrate analogue.

SCOP Domain Sequences for d1dy3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dy3a_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

SCOP Domain Coordinates for d1dy3a_:

Click to download the PDB-style file with coordinates for d1dy3a_.
(The format of our PDB-style files is described here.)

Timeline for d1dy3a_: