Lineage for d7a20b_ (7a20 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907681Protein automated matches [190054] (13 species)
    not a true protein
  7. 2907778Species Salmonella typhimurium [TaxId:90371] [189633] (15 PDB entries)
  8. 2907800Domain d7a20b_: 7a20 B: [394331]
    Other proteins in same PDB: d7a20a_, d7a20c_
    automated match to d4zqcb_
    complexed with 144, na

Details for d7a20b_

PDB Entry: 7a20 (more details), 2.5 Å

PDB Description: azobenzene-based inhibitors for tryptophan synthase
PDB Compounds: (B:) Tryptophan synthase alpha chain,Tryptophan synthase beta chain

SCOPe Domain Sequences for d7a20b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a20b_ c.79.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
tllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdilk

SCOPe Domain Coordinates for d7a20b_:

Click to download the PDB-style file with coordinates for d7a20b_.
(The format of our PDB-style files is described here.)

Timeline for d7a20b_: