Lineage for d1eqoa_ (1eqo A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 33079Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) (S)
  5. 33080Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)
  6. 33081Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (2 species)
  7. 33082Species Escherichia coli [TaxId:562] [55086] (3 PDB entries)
  8. 33083Domain d1eqoa_: 1eqo A: [39432]

Details for d1eqoa_

PDB Entry: 1eqo (more details), 1.25 Å

PDB Description: crystal structure of a ternary complex of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase from e. coli with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.25 angstrom resolution

SCOP Domain Sequences for d1eqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqoa_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

SCOP Domain Coordinates for d1eqoa_:

Click to download the PDB-style file with coordinates for d1eqoa_.
(The format of our PDB-style files is described here.)

Timeline for d1eqoa_: