![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) ![]() |
![]() | Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein) |
![]() | Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55086] (3 PDB entries) |
![]() | Domain d1eqoa_: 1eqo A: [39432] |
PDB Entry: 1eqo (more details), 1.25 Å
SCOP Domain Sequences for d1eqoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eqoa_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli} tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw
Timeline for d1eqoa_: