Lineage for d1fx4a_ (1fx4 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725665Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 725666Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 725707Protein Receptor-type monomeric adenylyl cyclase [55081] (1 species)
  7. 725708Species Trypanosome (Trypanosoma brucei), different isoform [TaxId:5691] [55082] (2 PDB entries)
  8. 725710Domain d1fx4a_: 1fx4 A: [39431]
    variant Gresag 4.3
    complexed with mg

Details for d1fx4a_

PDB Entry: 1fx4 (more details), 1.9 Å

PDB Description: structure analysis of adenylate cyclases from trypanosoma brucei in their monomeric state
PDB Compounds: (A:) receptor-type adenylate cyclase gresag 4.3

SCOP Domain Sequences for d1fx4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx4a_ d.58.29.1 (A:) Receptor-type monomeric adenylyl cyclase {Trypanosome (Trypanosoma brucei), different isoform [TaxId: 5691]}
dndsapkeptgpvtliftdiesstalwaahpdlmpdavathhrlirslitryecyevktv
gdsfmiaskspfaavqlaqelqlcflrldwetnavdesyrefeeqraegeceytpptasl
dpevysrlwnglrvrvgihtglcdirydevtkgydyygrtsnmaartesvanggqvlmth
aaymslsgedrnqldvttlgatvlrgvpepvrmyqlnavpgrnfaalrldr

SCOP Domain Coordinates for d1fx4a_:

Click to download the PDB-style file with coordinates for d1fx4a_.
(The format of our PDB-style files is described here.)

Timeline for d1fx4a_: