Lineage for d7acab_ (7aca B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868149Domain d7acab_: 7aca B: [394302]
    automated match to d5us4a_
    complexed with edo, gcp, mg, r6w

Details for d7acab_

PDB Entry: 7aca (more details), 1.57 Å

PDB Description: crystal structure of an active kras g12d (gppcp) dimer in complex with bi-5747
PDB Compounds: (B:) GTPase KRas

SCOPe Domain Sequences for d7acab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7acab_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

SCOPe Domain Coordinates for d7acab_:

Click to download the PDB-style file with coordinates for d7acab_.
(The format of our PDB-style files is described here.)

Timeline for d7acab_: