SCOP 1.71: Domain d1fx2a_: 1fx2 A:

Lineage for d1fx2a_ (1fx2 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
   Pfam 00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Receptor-type monomeric adenylyl cyclase [55081] (1 species)

7. Species Trypanosome (Trypanosoma brucei), different isoform [TaxId:5691] [55082] (2 PDB entries)

8. Domain d1fx2a_: 1fx2 A: [39430]
   variant Gresag 4.1
   complexed with dtt, so4

Details for d1fx2a_

PDB Entry: 1fx2, 1.46 Å

PDB Description: structural analysis of adenylate cyclases from trypanosoma brucei in their monomeric state

SCOP Domain Sequences for d1fx2a_:

Sequence; same for both SEQRES and ATOM records:

>d1fx2a_ d.58.29.1 (A:) Receptor-type monomeric adenylyl cyclase {Trypanosome (Trypanosoma brucei), different isoform}
nnnrapkeptdpvtliftdiesstalwaahpdlmpdavaahhrmvrsligrykcyevktv
gdsfmiaskspfaavqlaqelqlcflhhdwgtnalddsyrefeeqraegeceytpptahm
dpevysrlwnglrvrvgihtglcdirhdevtkgydyygrtpnmaartesvanggqvlmth
aaymslsaedrkqidvtalgdvalrgvsdpvkmyqlntvpsrnfaalrldreyfd

Timeline for d1fx2a_:

• d1fx2a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fx2a_ appears in SCOP 1.69
  
• d1fx2a_ appears in SCOP 1.73
  
• d1fx2a_ appears in the current release, SCOPe 2.08