SCOP 1.75: Domain d1cjvb_: 1cjv B:

Lineage for d1cjvb_ (1cjv B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries)

8. Domain d1cjvb_: 1cjv B: [39429]
   Other proteins in same PDB: d1cjva_, d1cjvc1, d1cjvc2
   complexed with cl, dad, fok, gsp, mes, mg, zn; mutant

Details for d1cjvb_

PDB Entry: 1cjv, 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mg, and zn

PDB Compounds: (B:) adenylate cyclase, type II

SCOP Domain Sequences for d1cjvb_:

Sequence, based on SEQRES records:

>d1cjvb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records):

>d1cjvb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpviagv
igaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkgd
lktyfvnt

Timeline for d1cjvb_:

• d1cjvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cjvb_ appears in SCOP 1.73
  
• d1cjvb_ appears in SCOPe 2.01
  
• d1cjvb_ appears in the current release, SCOPe 2.08