Lineage for d1cjkb_ (1cjk B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910831Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1910832Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 1910851Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species)
  7. 1910852Species Norway rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries)
  8. 1910858Domain d1cjkb_: 1cjk B: [39428]
    Other proteins in same PDB: d1cjka_, d1cjkc1, d1cjkc2
    complexed with cl, fok, gsp, mes, mg, mn, tat

Details for d1cjkb_

PDB Entry: 1cjk (more details), 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5'-(alpha thio)-triphosphate (rp), mg, and mn
PDB Compounds: (B:) adenylate cyclase, type II

SCOPe Domain Sequences for d1cjkb_:

Sequence, based on SEQRES records: (download)

>d1cjkb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvek
iktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfkl
rvginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytc
tcrgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d1cjkb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvek
iktigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpvia
gvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgk
gdlktyfvnt

SCOPe Domain Coordinates for d1cjkb_:

Click to download the PDB-style file with coordinates for d1cjkb_.
(The format of our PDB-style files is described here.)

Timeline for d1cjkb_: