Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Adenylyl and guanylyl cyclase catalytic domain [55073] (1 family) common fold is elaborated with additional secondary structures |
Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (4 proteins) structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries) |
Domain d1cjkb_: 1cjk B: [39428] Other proteins in same PDB: d1cjka_, d1cjkc1, d1cjkc2 complexed with ags, cl, fok, gsp, mes, mg, mn; mutant |
PDB Entry: 1cjk (more details), 3 Å
SCOP Domain Sequences for d1cjkb_:
Sequence, based on SEQRES records: (download)
>d1cjkb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus)} lyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvek iktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfkl rvginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytc tcrgiinvkgkgdlktyfvnt
>d1cjkb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus)} lyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvek iktigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpvia gvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgk gdlktyfvnt
Timeline for d1cjkb_: