SCOPe 2.01: Domain d1cjtb_: 1cjt B:

Lineage for d1cjtb_ (1cjt B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries)

8. Domain d1cjtb_: 1cjt B: [39426]
   Other proteins in same PDB: d1cjta_, d1cjtc1, d1cjtc2
   complexed with cl, dad, fok, gsp, mes, mg, mn

Details for d1cjtb_

PDB Entry: 1cjt, 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mn, and mg

PDB Compounds: (B:) adenylate cyclase, type II

SCOPe Domain Sequences for d1cjtb_:

Sequence, based on SEQRES records:

>d1cjtb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
ktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklr
vginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytct
crgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records):

>d1cjtb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
ktigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
dlktyfvnt

Timeline for d1cjtb_:

• d1cjtb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cjtb_ appears in SCOP 1.75
  
• d1cjtb_ appears in SCOPe 2.02
  
• d1cjtb_ appears in the current release, SCOPe 2.08