Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (34 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries) |
Domain d7acfc_: 7acf C: [394254] Other proteins in same PDB: d7acfa2 automated match to d5us4a_ complexed with gcp, mg, r6w |
PDB Entry: 7acf (more details), 1.91 Å
SCOPe Domain Sequences for d7acfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7acfc_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
Timeline for d7acfc_:
View in 3D Domains from other chains: (mouse over for more information) d7acfa1, d7acfa2, d7acfb_, d7acfd_ |