Lineage for d1cs4b_ (1cs4 B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725665Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 725666Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 725685Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species)
  7. 725686Species Rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries)
  8. 725689Domain d1cs4b_: 1cs4 B: [39425]
    Other proteins in same PDB: d1cs4a_, d1cs4c1, d1cs4c2
    complexed with 101, cl, fok, gsp, mes, mg, pop; mutant

Details for d1cs4b_

PDB Entry: 1cs4 (more details), 2.5 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg
PDB Compounds: (B:) type II adenylate cyclase

SCOP Domain Sequences for d1cs4b_:

Sequence, based on SEQRES records: (download)

>d1cs4b_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus) [TaxId: 10116]}
yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
ktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklr
vginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytct
crgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d1cs4b_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus) [TaxId: 10116]}
yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
ktigstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpvia
gvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgk
gdlktyfvnt

SCOP Domain Coordinates for d1cs4b_:

Click to download the PDB-style file with coordinates for d1cs4b_.
(The format of our PDB-style files is described here.)

Timeline for d1cs4b_: