SCOPe 2.07: Domain d7a9dc1: 7a9d C:1-321

Lineage for d7a9dc1 (7a9d C:1-321)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza a virus (a/duck/alberta/60/1976(h12n5)) [TaxId:385582] [394238] (1 PDB entry)

8. Domain d7a9dc1: 7a9d C:1-321 [394240]
   Other proteins in same PDB: d7a9da2, d7a9db_, d7a9dc2, d7a9dd_
   automated match to d4d00c_
   complexed with nag

Details for d7a9dc1

PDB Entry: 7a9d, 2.7 Å

PDB Description: crystal structure of h12 haemagglutinin

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d7a9dc1:

Sequence; same for both SEQRES and ATOM records:

>d7a9dc1 b.19.1.0 (C:1-321) automated matches {Influenza a virus (a/duck/alberta/60/1976(h12n5)) [TaxId: 385582]}
dkicigyqtnnstetvntlseqnvpvtqveelvhggidpilcgtelgsplvlddcslegl
ilgnpkcdlylngrewsyiverpkemegvcypgsienqeelrslfssikkyervkmfdft
kwnvtytgtskacnntsnqgsfyrsmrwltlksgqfpvqtdeykntrdsdivftwaihhp
ptsdeqvklyknpdtlssvttdeinrsfkpnigprplvrgqqgrmdyywavlkpgqtvki
qtngnliapeyghlitgkshgrilknnlpmgqcvtecqlnegvmntskpfqntskhyigk
cpkyipsgslklaiglrnvpq

Timeline for d7a9dc1:

• d7a9dc1 is new in SCOPe 2.07-stable
  
• d7a9dc1 appears in the current release, SCOPe 2.08