Lineage for d1culb_ (1cul B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 413082Superfamily d.58.29: Adenylyl and guanylyl cyclase catalytic domain [55073] (1 family) (S)
    common fold is elaborated with additional secondary structures
  5. 413083Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (4 proteins)
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 413084Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species)
  7. 413085Species Rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries)
  8. 413087Domain d1culb_: 1cul B: [39424]
    Other proteins in same PDB: d1cula_, d1culc1, d1culc2
    complexed with 103, 3po, cl, fok, gsp, mes, mg; mutant

Details for d1culb_

PDB Entry: 1cul (more details), 2.4 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2',5'-dideoxy-adenosine 3'-triphosphate and mg

SCOP Domain Sequences for d1culb_:

Sequence, based on SEQRES records: (download)

>d1culb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus)}
yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
ktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklr
vginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytct
crgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records): (download)

>d1culb_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Rat (Rattus norvegicus)}
yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
ktigstymaatglsaerqymhigtmvefayalvgkldainkhsfndfklrvginhgpvia
gvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgk
gdlktyfvnt

SCOP Domain Coordinates for d1culb_:

Click to download the PDB-style file with coordinates for d1culb_.
(The format of our PDB-style files is described here.)

Timeline for d1culb_: