Lineage for d7a9dd_ (7a9d D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646437Species Influenza a virus (a/duck/alberta/60/1976(h12n5)) [TaxId:385582] [394236] (1 PDB entry)
  8. 2646439Domain d7a9dd_: 7a9d D: [394237]
    Other proteins in same PDB: d7a9da1, d7a9da2, d7a9dc1, d7a9dc2
    automated match to d5bnyf_
    complexed with nag

Details for d7a9dd_

PDB Entry: 7a9d (more details), 2.7 Å

PDB Description: crystal structure of h12 haemagglutinin
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d7a9dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a9dd_ h.3.1.0 (D:) automated matches {Influenza a virus (a/duck/alberta/60/1976(h12n5)) [TaxId: 385582]}
glfgaiagfieggwpglvagwygfqhqnaegtgiaadrdstqraidnmqnklnnvidkmn
kqfevvnhefsevesrinminskiddqitdiwaynaellvllenqktldehdanvrnlhd
rvrrvlrenaidtgdgcfeilhkcdnncmdtirngtynhkeyeeesk

SCOPe Domain Coordinates for d7a9dd_:

Click to download the PDB-style file with coordinates for d7a9dd_.
(The format of our PDB-style files is described here.)

Timeline for d7a9dd_: