![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
![]() | Protein Nickel-binding periplasmic protein NikA [102694] (2 species) similar domain organization to oligo- and dipeptide-binding protein |
![]() | Species Escherichia coli [TaxId:562] [102695] (28 PDB entries) |
![]() | Domain d7a0cb_: 7a0c B: [394231] automated match to d1zlqa1 complexed with act, cl, fe, gol, mg, qtt |
PDB Entry: 7a0c (more details), 1.9 Å
SCOPe Domain Sequences for d7a0cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a0cb_ c.94.1.1 (B:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]} pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn ipyapiateipfeqikpv
Timeline for d7a0cb_: