Lineage for d1cjva_ (1cjv A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863614Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 863615Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 863643Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)
  7. 863644Species Dog (Canis familiaris) [TaxId:9615] [55078] (11 PDB entries)
    Uniprot P30803 458-646
  8. 863651Domain d1cjva_: 1cjv A: [39422]
    Other proteins in same PDB: d1cjvb_, d1cjvc1, d1cjvc2
    complexed with cl, dad, fok, gsp, mes, mg, zn; mutant

Details for d1cjva_

PDB Entry: 1cjv (more details), 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mg, and zn
PDB Compounds: (A:) adenylate cyclase, type v

SCOP Domain Sequences for d1cjva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjva_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

SCOP Domain Coordinates for d1cjva_:

Click to download the PDB-style file with coordinates for d1cjva_.
(The format of our PDB-style files is described here.)

Timeline for d1cjva_: