SCOP 1.75: Domain d1cjua_: 1cju A:

Lineage for d1cjua_ (1cju A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [55078] (11 PDB entries)
   Uniprot P30803 458-646

8. Domain d1cjua_: 1cju A: [39420]
   Other proteins in same PDB: d1cjub_, d1cjuc1, d1cjuc2
   complexed with cl, dad, fok, gsp, mg; mutant

Details for d1cjua_

PDB Entry: 1cju, 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp and mg

PDB Compounds: (A:) adenylate cyclase, type v

SCOP Domain Sequences for d1cjua_:

Sequence; same for both SEQRES and ATOM records:

>d1cjua_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

Timeline for d1cjua_:

• d1cjua_ first appeared (with stable ids) in SCOP 1.55
  
• d1cjua_ appears in SCOP 1.73
  
• d1cjua_ appears in SCOPe 2.01
  
• d1cjua_ appears in the current release, SCOPe 2.08