SCOP 1.73: Domain d1cjta_: 1cjt A:

Lineage for d1cjta_ (1cjt A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [55078] (11 PDB entries)

8. Domain d1cjta_: 1cjt A: [39419]
   Other proteins in same PDB: d1cjtb_, d1cjtc1, d1cjtc2
   complexed with cl, dad, fok, gsp, mes, mg, mn; mutant

Details for d1cjta_

PDB Entry: 1cjt, 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mn, and mg

PDB Compounds: (A:) adenylate cyclase, type v

SCOP Domain Sequences for d1cjta_:

Sequence; same for both SEQRES and ATOM records:

>d1cjta_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

Timeline for d1cjta_:

• d1cjta_ first appeared (with stable ids) in SCOP 1.55
  
• d1cjta_ appears in SCOP 1.71
  
• d1cjta_ appears in SCOP 1.75
  
• d1cjta_ appears in the current release, SCOPe 2.08