![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins) Pfam 00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
![]() | Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species) |
![]() | Species Dog (Canis familiaris) [TaxId:9615] [55078] (9 PDB entries) |
![]() | Domain d1azsa_: 1azs A: [39416] Other proteins in same PDB: d1azsb_, d1azsc1, d1azsc2 complexed with fkp, gsp, mg; mutant |
PDB Entry: 1azs (more details), 2.3 Å
SCOP Domain Sequences for d1azsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azsa_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris)} dmmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclri kilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcg vlglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylk ehsietflil
Timeline for d1azsa_: