Lineage for d1azsa_ (1azs A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604796Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 604797Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
    Pfam 00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 604825Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)
  7. 604826Species Dog (Canis familiaris) [TaxId:9615] [55078] (9 PDB entries)
  8. 604827Domain d1azsa_: 1azs A: [39416]
    Other proteins in same PDB: d1azsb_, d1azsc1, d1azsc2
    complexed with fkp, gsp, mg; mutant

Details for d1azsa_

PDB Entry: 1azs (more details), 2.3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase

SCOP Domain Sequences for d1azsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azsa_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris)}
dmmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclri
kilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcg
vlglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylk
ehsietflil

SCOP Domain Coordinates for d1azsa_:

Click to download the PDB-style file with coordinates for d1azsa_.
(The format of our PDB-style files is described here.)

Timeline for d1azsa_: