SCOPe 2.07: Domain d6ztvd2: 6ztv D:598-753

Lineage for d6ztvd2 (6ztv D:598-753)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (24 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [370657] (5 PDB entries)

8. Domain d6ztvd2: 6ztv D:598-753 [394146]
   Other proteins in same PDB: d6ztva1, d6ztvb1, d6ztvc1, d6ztvd1
   automated match to d1p80a1
   complexed with edo, gol, hdd

Details for d6ztvd2

PDB Entry: 6ztv, 1.78 Å

PDB Description: crystal structure of catalase hpii from escherichia coli (serendipitously crystallized)

PDB Compounds: (D:) catalase hpii

SCOPe Domain Sequences for d6ztvd2:

Sequence; same for both SEQRES and ATOM records:

>d6ztvd2 c.23.16.0 (D:598-753) automated matches {Escherichia coli [TaxId: 83333]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d6ztvd2:

• d6ztvd2 is new in SCOPe 2.07-stable
  
• d6ztvd2 appears in the current release, SCOPe 2.08