SCOPe 2.07: Domain d6zsib_: 6zsi B:

Lineage for d6zsib_ (6zsi B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)

8. Domain d6zsib_: 6zsi B: [394144]
   automated match to d1zbda_
   complexed with gnp, mg, peg

Details for d6zsib_

PDB Entry: 6zsi, 1.91 Å

PDB Description: the mechanism of activation of the actin binding protein ehbp1 by rab8 family members.

PDB Compounds: (B:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d6zsib_:

Sequence; same for both SEQRES and ATOM records:

>d6zsib_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktydylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiw
dtagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnk
cdvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdk

Timeline for d6zsib_:

• d6zsib_ is new in SCOPe 2.07-stable
  
• d6zsib_ appears in the current release, SCOPe 2.08