Lineage for d1ab8a_ (1ab8 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863614Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 863615Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 863660Protein Type II adenylyl cyclase C2 domain [55075] (1 species)
  7. 863661Species Rat (Rattus norvegicus) [TaxId:10116] [55076] (5 PDB entries)
    Uniprot P26769 879-1077
  8. 863662Domain d1ab8a_: 1ab8 A: [39414]

Details for d1ab8a_

PDB Entry: 1ab8 (more details), 2.2 Å

PDB Description: rat type ii adenylyl cyclase c2 domain/forskolin complex
PDB Compounds: (A:) adenylyl cyclase

SCOP Domain Sequences for d1ab8a_:

Sequence, based on SEQRES records: (download)

>d1ab8a_ d.58.29.1 (A:) Type II adenylyl cyclase C2 domain {Rat (Rattus norvegicus) [TaxId: 10116]}
lyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvek
iktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfkl
rvginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytc
tcrgiinvkgkgdlktyfvn

Sequence, based on observed residues (ATOM records): (download)

>d1ab8a_ d.58.29.1 (A:) Type II adenylyl cyclase C2 domain {Rat (Rattus norvegicus) [TaxId: 10116]}
lyhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvek
iktigstymaatglsaipsqqymhigtmvefayalvgkldainkhsfndfklrvginhgp
viagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcfvn

SCOP Domain Coordinates for d1ab8a_:

Click to download the PDB-style file with coordinates for d1ab8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ab8a_: