Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (4 families) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (17 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein Guanine nucleotide-binding protein subunit beta-2-like 1 (GNB2L1 or RACK1) [267639] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [267698] (14 PDB entries) |
Domain d6zojg_: 6zoj g: [394121] automated match to d3j3ag_ protein/RNA complex; complexed with mg, zn |
PDB Entry: 6zoj (more details), 2.8 Å
SCOPe Domain Sequences for d6zojg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zojg_ b.69.4.1 (g:) Guanine nucleotide-binding protein subunit beta-2-like 1 (GNB2L1 or RACK1) {Human (Homo sapiens) [TaxId: 9606]} teqmtlrgtlkghngwvtqiattpqfpdmilsasrdktiimwkltrdetnygipqralrg hshfvsdvvissdgqfalsgswdgtlrlwdlttgtttrrfvghtkdvlsvafssdnrqiv sgsrdktiklwntlgvckytvqdeshsewvscvrfspnssnpiivscgwdklvkvwnlan cklktnhightgylntvtvspdgslcasggkdgqamlwdlnegkhlytldggdiinalcf spnrywlcaatgpsikiwdlegkiivdelkqevistsskaeppqctslawsadgqtlfag ytdnlvrvwqvtig
Timeline for d6zojg_: