Lineage for d1ff3b_ (1ff3 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561596Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2561597Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)
  6. 2561598Protein Peptide methionine sulfoxide reductase [55070] (4 species)
  7. 2561603Species Escherichia coli [TaxId:562] [55072] (2 PDB entries)
  8. 2561605Domain d1ff3b_: 1ff3 B: [39412]
    complexed with so4

Details for d1ff3b_

PDB Entry: 1ff3 (more details), 1.9 Å

PDB Description: structure of the peptide methionine sulfoxide reductase from escherichia coli
PDB Compounds: (B:) peptide methionine sulfoxide reductase

SCOPe Domain Sequences for d1ff3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ff3b_ d.58.28.1 (B:) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]}
slfdkkhlvspadalpgrntpmpvatlhavnghsmtnvpdgmeiaifamgcfwgverlfw
qlpgvystaagytggytpnptyrevcsgdtghaeavrivydpsvisyeqllqvfwenhdp
aqgmrqgndhgtqyrsaiypltpeqdaaaraslerfqaamlaadddrhitteianatpfy
yaeddhqqylhknp

SCOPe Domain Coordinates for d1ff3b_:

Click to download the PDB-style file with coordinates for d1ff3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ff3b_: