Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) common fold is elaborated with additional secondary structures |
Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins) |
Protein Peptide methionine sulfoxide reductase [55070] (4 species) |
Species Escherichia coli [TaxId:562] [55072] (2 PDB entries) |
Domain d1ff3b_: 1ff3 B: [39412] complexed with so4 |
PDB Entry: 1ff3 (more details), 1.9 Å
SCOPe Domain Sequences for d1ff3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ff3b_ d.58.28.1 (B:) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]} slfdkkhlvspadalpgrntpmpvatlhavnghsmtnvpdgmeiaifamgcfwgverlfw qlpgvystaagytggytpnptyrevcsgdtghaeavrivydpsvisyeqllqvfwenhdp aqgmrqgndhgtqyrsaiypltpeqdaaaraslerfqaamlaadddrhitteianatpfy yaeddhqqylhknp
Timeline for d1ff3b_: