SCOPe 2.08: Domain d1ff3b_: 1ff3 B:

Lineage for d1ff3b_ (1ff3 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)

6. Protein Peptide methionine sulfoxide reductase [55070] (4 species)

7. Species Escherichia coli [TaxId:562] [55072] (2 PDB entries)

8. Domain d1ff3b_: 1ff3 B: [39412]
   complexed with so4

Details for d1ff3b_

PDB Entry: 1ff3, 1.9 Å

PDB Description: structure of the peptide methionine sulfoxide reductase from escherichia coli

PDB Compounds: (B:) peptide methionine sulfoxide reductase

SCOPe Domain Sequences for d1ff3b_:

Sequence; same for both SEQRES and ATOM records:

>d1ff3b_ d.58.28.1 (B:) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]}
slfdkkhlvspadalpgrntpmpvatlhavnghsmtnvpdgmeiaifamgcfwgverlfw
qlpgvystaagytggytpnptyrevcsgdtghaeavrivydpsvisyeqllqvfwenhdp
aqgmrqgndhgtqyrsaiypltpeqdaaaraslerfqaamlaadddrhitteianatpfy
yaeddhqqylhknp

Timeline for d1ff3b_:

• d1ff3b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ff3b_ appears in SCOPe 2.07