SCOPe 2.06: Domain d1fvab_: 1fva B:

Lineage for d1fvab_ (1fva B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)

6. Protein Peptide methionine sulfoxide reductase [55070] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55071] (2 PDB entries)

8. Domain d1fvab_: 1fva B: [39410]

Details for d1fvab_

PDB Entry: 1fva, 1.7 Å

PDB Description: crystal structure of bovine methionine sulfoxide reductase

PDB Compounds: (B:) peptide methionine sulfoxide reductase

SCOPe Domain Sequences for d1fvab_:

Sequence; same for both SEQRES and ATOM records:

>d1fvab_ d.58.28.1 (B:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]}
ivspqealpgrkeplvvaakhhvngnrtvepfpegtqmavfgmgcfwgaerkfwtlkgvy
stqvgfaggytpnptykevcsgktghaevvrvvfqpehisfeellkvfwenhdptqgmrq
gndhgsqyrsaiyptsaehvgaalkskedyqkvlsehgfglittdiregqtfyyaedyhq
qylskdpdgycglggtgvscp

Timeline for d1fvab_:

• d1fvab_ first appeared (with stable ids) in SCOP 1.55
  
• d1fvab_ appears in SCOPe 2.05
  
• d1fvab_ appears in SCOPe 2.07
  
• d1fvab_ appears in the current release, SCOPe 2.08