Lineage for d1fvaa_ (1fva A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197629Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2197630Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)
  6. 2197631Protein Peptide methionine sulfoxide reductase [55070] (4 species)
  7. 2197632Species Cow (Bos taurus) [TaxId:9913] [55071] (2 PDB entries)
  8. 2197634Domain d1fvaa_: 1fva A: [39409]

Details for d1fvaa_

PDB Entry: 1fva (more details), 1.7 Å

PDB Description: crystal structure of bovine methionine sulfoxide reductase
PDB Compounds: (A:) peptide methionine sulfoxide reductase

SCOPe Domain Sequences for d1fvaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvaa_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]}
vspqealpgrkeplvvaakhhvngnrtvepfpegtqmavfgmgcfwgaerkfwtlkgvys
tqvgfaggytpnptykevcsgktghaevvrvvfqpehisfeellkvfwenhdptqgmrqg
ndhgsqyrsaiyptsaehvgaalkskedyqkvlsehgfglittdiregqtfyyaedyhqq
ylskdpdgycglggtgvscp

SCOPe Domain Coordinates for d1fvaa_:

Click to download the PDB-style file with coordinates for d1fvaa_.
(The format of our PDB-style files is described here.)

Timeline for d1fvaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fvab_