Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Bacillus cereus [TaxId:1396] [394075] (2 PDB entries) |
Domain d6zlab_: 6zla B: [394089] Other proteins in same PDB: d6zlaa2, d6zlad2 automated match to d1r6da_ complexed with nad |
PDB Entry: 6zla (more details), 2.2 Å
SCOPe Domain Sequences for d6zlab_:
Sequence, based on SEQRES records: (download)
>d6zlab_ c.2.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]} mkilvtgaagfigshlcqallknsayhvvgidhfigptpatlktgniqslelnsrfqfir edilntdlskllqdidvvyhlaaipgvrtswgkdfqpyvtnnimvtqqlleackhikldk fihistssvygeksgavsedllpiplspygvtklsgehlchvyhknfhipivilryftvy gprqrpdmafhrlikqmledkpltifgdgtqtrdftyiddcirgtvaaletkkniigevi niggkeqasildiismlekisgksatknflksvpgepkqtwadiskastllqysptvsls dgleaeydyikqlyk
>d6zlab_ c.2.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]} mkilvtgaagfigshlcqallknsayhvvgidhfigptpatlktgniqslelnsrfqfir edilntdlskllqdidvvyhlaaipgwgkdfqpyvtnnimvtqqlleackhikldkfihi stssvygeksgavsedllpiplspygvtklsgehlchvyhknfhipivilryftvygprq rpdmafhrlikqmledkpltifgdgtqtrdftyiddcirgtvaaletkkniigevinigg keqasildiismlekisgksatknflkpkqtwadiskastllqysptvslsdgleaeydy ikqlyk
Timeline for d6zlab_: