Lineage for d1fvga_ (1fvg A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (1 family) 
Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (1 protein) Protein Peptide methionine sulfoxide reductase [55070] (2 species) Species Cow (Bos taurus) [TaxId:9913] [55071] (2 PDB entries) 
Domain d1fvga_: 1fvg A: [39408]
Details for d1fvga_
PDB Entry: 1fvg (more details), 1.6 Å
PDB Description: crystal structure of bovine peptide methionine sulfoxide reductase
SCOP Domain Sequences for d1fvga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvga_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Cow (Bos taurus)}
kivspqealpgrkeplvvaakhhvngnrtvepfpegtqmavfgmgcfwgaerkfwtlkgv
ystqvgfaggytpnptykevcsgktghaevvrvvfqpehisfeellkvfwenhdptqgmr
qgndhgsqyrsaiyptsaehvgaalkskedyqkvlsehgfglittdiregqtfyyaedyh
qqylskdpdgyc
SCOP Domain Coordinates for d1fvga_:
Click to download the PDB-style file with coordinates for d1fvga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fvga_:
- d1fvga_ appears in SCOP 1.57
- d1fvga_ appears in the current release, SCOPe 2.08
View in 3D